PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G34470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 318aa    MW: 34930.4 Da    PI: 6.9015
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G34470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.51.9e-5151651128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...................................kvkaeekewyfFs 62 
                   lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePwdLp+                                   k++ +ekewyfFs
  OB03G34470.1   5 LPPGFRFHPTDEELVTYYLTRKVSDFAFAT-RAIADVDLNKCEPWDLPNdkrplyatlytyknvkimnewirssnihmdgweagKASMGEKEWYFFS 100
                   79*************************999.89**************96689**********************99999998876667999****** PP

           NAM  63 krdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    rd+ky+tg r+nrat+sgyWk+tgkdke+++ +g lvg+kktLvfy+grapkg kt+Wvmheyrl
  OB03G34470.1 101 MRDRKYPTGIRTNRATESGYWKTTGKDKEIFH-GGMLVGMKKTLVFYRGRAPKGAKTSWVMHEYRL 165
                   ********************************.*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-55353IPR003441NAC domain
PROSITE profilePS5100556.3625186IPR003441NAC domain
PfamPF023651.1E-286165IPR003441NAC domain
SuperFamilySSF1019411.57E-5586186IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLTRKVSDF AFATRAIADV DLNKCEPWDL PNDKRPLYAT  60
LYTYKNVKIM NEWIRSSNIH MDGWEAGKAS MGEKEWYFFS MRDRKYPTGI RTNRATESGY  120
WKTTGKDKEI FHGGMLVGMK KTLVFYRGRA PKGAKTSWVM HEYRLQTKFP YKPSKDEWVV  180
CRVFKKCQLL KIRPPMAHDD DGAEHHLVDD GSPCGGGGGH AGGSSSLGDL GELDVSSILG  240
GFASSANAAP LCHGGGGGGE SFGAHRLDVG AQARDVGVSL ANVGADALFG GALSAKVDME  300
CGEQAAHLDM DDATWRAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-51518617165NAC domain-containing protein 19
4dul_A1e-51518617165NAC domain-containing protein 19
1ut7_B1e-51518617165NO APICAL MERISTEM PROTEIN
1ut7_A1e-51518617165NO APICAL MERISTEM PROTEIN
1ut4_B1e-51518617165NO APICAL MERISTEM PROTEIN
1ut4_A1e-51518617165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0927801e-119AC092780.6 Oryza sativa chromosome 3 BAC OSJNBb0079B16 genomic sequence, complete sequence.
GenBankAP0149591e-119AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126111e-119CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015689976.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
SwissprotO040179e-73NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLJ3LQX10.0J3LQX1_ORYBR; Uncharacterized protein
STRINGOB03G34470.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.14e-85NAC domain containing protein 58